Paralogue Annotation for ANK2 residue 2770

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2770
Reference Amino Acid: E - Glutamate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2770

No paralogue variants have been mapped to residue 2770 for ANK2.

ANK2	DGHGCEAMSPSSSAAPVSSGLQSPTGDDVD>E<QPVIYKESLALQGTHEKDTEGEELDVSRAE	2800
ANK1	------------------------------>-<------------------------------
ANK3	--FGLGLDSPQNEIAQ-----------N-->-<------------------------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.E2770D	c.8310A>C	Putative Benign		rs74743698	SIFT: tolerated Polyphen: benign