Paralogue Annotation for ANK2 residue 2773

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2773
Reference Amino Acid: V - Valine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2773

No paralogue variants have been mapped to residue 2773 for ANK2.

ANK2	GCEAMSPSSSAAPVSSGLQSPTGDDVDEQP>V<IYKESLALQGTHEKDTEGEELDVSRAESPQ	2803
ANK1	------------------------------>-<------------------------------
ANK3	GLGLDSPQNEIAQ-----------N----->-<------------------------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.V2773A	c.8318T>C	Putative Benign			SIFT: Polyphen:
p.V2773F	c.8317G>T	Putative Benign			SIFT: Polyphen: benign