Paralogue Annotation for ANK2 residue 2774

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2774
Reference Amino Acid: I - Isoleucine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2774

No paralogue variants have been mapped to residue 2774 for ANK2.

ANK2	CEAMSPSSSAAPVSSGLQSPTGDDVDEQPV>I<YKESLALQGTHEKDTEGEELDVSRAESPQA	2804
ANK1	------------------------------>-<------------------------------
ANK3	LGLDSPQNEIAQ-----------N------>-<------------------------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.I2774V	c.8320A>G	Putative Benign			SIFT: Polyphen: