Paralogue Annotation for ANK2 residue 2777

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2777
Reference Amino Acid: E - Glutamate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2777

No paralogue variants have been mapped to residue 2777 for ANK2.

ANK2	MSPSSSAAPVSSGLQSPTGDDVDEQPVIYK>E<SLALQGTHEKDTEGEELDVSRAESPQADCP	2807
ANK1	------------------------------>-<------------------------------
ANK3	DSPQNEIAQ-----------N--------->-<------------------------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.E2777K	c.8329G>A	Putative Benign			SIFT: Polyphen: benign