Paralogue Annotation for ANK2 residue 2780

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2780
Reference Amino Acid: A - Alanine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2780

No paralogue variants have been mapped to residue 2780 for ANK2.

ANK2	SSSAAPVSSGLQSPTGDDVDEQPVIYKESL>A<LQGTHEKDTEGEELDVSRAESPQADCPSES	2810
ANK1	------------------------------>-<------------------------------
ANK3	QNEIAQ-----------N------------>-<------------------------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.A2780S	c.8338G>T	Putative Benign			SIFT: Polyphen:
p.A2780P	c.8338G>C	Putative Benign			SIFT: Polyphen: