Paralogue Annotation for ANK2 residue 2783

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2783
Reference Amino Acid: G - Glycine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2783

No paralogue variants have been mapped to residue 2783 for ANK2.

ANK2	AAPVSSGLQSPTGDDVDEQPVIYKESLALQ>G<THEKDTEGEELDVSRAESPQADCPSESFSS	2813
ANK1	------------------------------>-<------------------------------
ANK3	IAQ-----------N--------------->-<---------------------------GNN	3388
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.G2783D	c.8348G>A	Putative Benign		rs199538455	SIFT: tolerated Polyphen: benign