Paralogue Annotation for ANK2 residue 2784

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2784
Reference Amino Acid: T - Threonine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2784

No paralogue variants have been mapped to residue 2784 for ANK2.

ANK2	APVSSGLQSPTGDDVDEQPVIYKESLALQG>T<HEKDTEGEELDVSRAESPQADCPSESFSSS	2814
ANK1	------------------------------>-<------------------------------
ANK3	AQ-----------N---------------->-<--------------------------GNND	3389
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.T2784I	c.8351C>T	Putative Benign			SIFT: Polyphen: