Paralogue Annotation for ANK2 residue 2787

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2787
Reference Amino Acid: K - Lysine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2787

No paralogue variants have been mapped to residue 2787 for ANK2.

ANK2	SSGLQSPTGDDVDEQPVIYKESLALQGTHE>K<DTEGEELDVSRAESPQADCPSESFSSSSSL	2817
ANK1	------------------------------>-<------------------------------
ANK3	----------N------------------->-<-----------------------GNNDQSI	3392
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.K2787Q	c.8359A>C	Putative Benign		rs376908394	SIFT: tolerated Polyphen: benign