Paralogue Annotation for ANK2 residue 2802

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2802
Reference Amino Acid: P - Proline
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2802

No paralogue variants have been mapped to residue 2802 for ANK2.

ANK2	PVIYKESLALQGTHEKDTEGEELDVSRAES>P<QADCPSESFSSSSSLPHCLVSEGKELDEDI	2832
ANK1	------------------------------>-<------------------------------
ANK3	------------------------------>-<--------GNNDQSITECSIATTAEFSHDT	3407
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.P2802S	c.8404C>T	Benign		rs3733617	SIFT: tolerated Polyphen: benign