Paralogue Annotation for ANK2 residue 2814

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2814
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2814

No paralogue variants have been mapped to residue 2814 for ANK2.



ANK2THEKDTEGEELDVSRAESPQADCPSESFSS>S<SSLPHCLVSEGKELDEDISATSSIQKTEVT2844
ANK1------------------------------>-<------------------------------
ANK3---------------------------GNN>D<QSITECSIATTAEFSHDTDATEIDSLDGYD3419
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2814Lc.8441C>T Putative BenignSIFT:
Polyphen: benign