Paralogue Annotation for ANK2 residue 2842

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2842
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2842

No paralogue variants have been mapped to residue 2842 for ANK2.



ANK2SSSSSLPHCLVSEGKELDEDISATSSIQKT>E<VTKTDETFENLPKDCPSQDSSITTQTDRFS2872
ANK1------------------------------>-<------------------------------
ANK3NNDQSITECSIATTAEFSHDTDATEIDSLD>G<YDLQDEDDGLTESDSKLPIQAMEIKKDIWN3447
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2842Gc.8525A>G Putative BenignSIFT: tolerated
Polyphen: benign