No paralogue variants have been mapped to residue 2857 for ANK2.
| ANK2 | ELDEDISATSSIQKTEVTKTDETFENLPKD>C<PSQDSSITTQTDRFSMDVPVSDL------A | 2881 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | EFSHDTDATEIDSLDGYDLQDEDDGLTESD>S<KLPIQAMEIKKDIWNTEGILKPADRSFSQS | 3462 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.C2857Y | c.8570G>A | Putative Benign | rs372710129 | SIFT: tolerated Polyphen: benign |