Paralogue Annotation for ANK2 residue 2873

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2873
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2873

No paralogue variants have been mapped to residue 2873 for ANK2.



ANK2VTKTDETFENLPKDCPSQDSSITTQTDRFS>M<DVPVSDL------AENDEIYDPQITSPYEN2897
ANK1------------------------------>-<------------------------------
ANK3YDLQDEDDGLTESDSKLPIQAMEIKKDIWN>T<EGILKPADRSFSQSKLEVIEEEGKVGPDED3478
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M2873Vc.8617A>G Putative BenignSIFT: tolerated
Polyphen: benign