No paralogue variants have been mapped to residue 2915 for ANK2.
| ANK2 | EIYDPQITSPYENVPSQSFFSSEESKTQTD>A<NHTTSFHSSEVYSVTITSPVEDVVVASSSS | 2945 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | VIEEEGKVGPDEDKPPSKSSSSEKTPDKTD>Q<KSGAQFFTLEGRHPDRS------------- | 3513 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.A2915G | c.8744C>G | Putative Benign | rs138438183 | SIFT: Polyphen: benign |