Paralogue Annotation for ANK2 residue 2931

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2931
Reference Amino Acid: I - Isoleucine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2931

No paralogue variants have been mapped to residue 2931 for ANK2.

ANK2	QSFFSSEESKTQTDANHTTSFHSSEVYSVT>I<TSPVEDVVVASSSSGTVLSKESNFEGQDIK	2961
ANK1	------------------------------>-<------------------------------
ANK3	SKSSSSEKTPDKTDQKSGAQFFTLEGRHPD>R<S-----------------------------	3513
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.I2931M	c.8793C>G	Putative Benign		rs62313245	SIFT: tolerated Polyphen: benign
p.I2931V	c.8791A>G	Putative Benign		rs142940881	SIFT: Polyphen: benign