Paralogue Annotation for ANK2 residue 2938

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2938
Reference Amino Acid: V - Valine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2938

No paralogue variants have been mapped to residue 2938 for ANK2.

ANK2	ESKTQTDANHTTSFHSSEVYSVTITSPVED>V<VVASSSSGTVLSKESNFEGQDIKMESQQES	2968
ANK1	------------------------------>-<------------------------------
ANK3	KTPDKTDQKSGAQFFTLEGRHPDRS----->-<-------------------------VFPD-	3517
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.V2938I	c.8812G>A	Putative Benign			SIFT: Polyphen: