Paralogue Annotation for ANK2 residue 2939

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2939
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2939

No paralogue variants have been mapped to residue 2939 for ANK2.



ANK2SKTQTDANHTTSFHSSEVYSVTITSPVEDV>V<VASSSSGTVLSKESNFEGQDIKMESQQEST2969
ANK1------------------------------>-<------------------------------
ANK3TPDKTDQKSGAQFFTLEGRHPDRS------>-<------------------------VFPD--3517
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2939Ic.8815G>A Putative BenignSIFT:
Polyphen: benign