Paralogue Annotation for ANK2 residue 2939

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2939
Reference Amino Acid: V - Valine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2939

No paralogue variants have been mapped to residue 2939 for ANK2.

ANK2	SKTQTDANHTTSFHSSEVYSVTITSPVEDV>V<VASSSSGTVLSKESNFEGQDIKMESQQEST	2969
ANK1	------------------------------>-<------------------------------
ANK3	TPDKTDQKSGAQFFTLEGRHPDRS------>-<------------------------VFPD--	3517
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.V2939I	c.8815G>A	Putative Benign		rs140076489	SIFT: Polyphen: benign