Paralogue Annotation for ANK2 residue 2940

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2940
Reference Amino Acid: V - Valine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2940

No paralogue variants have been mapped to residue 2940 for ANK2.

ANK2	KTQTDANHTTSFHSSEVYSVTITSPVEDVV>V<ASSSSGTVLSKESNFEGQDIKMESQQESTL	2970
ANK1	------------------------------>-<------------------------------
ANK3	PDKTDQKSGAQFFTLEGRHPDRS------->-<-----------------------VFPD---	3517
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.V2940G	c.8819T>G	Putative Benign		rs142302291	SIFT: Polyphen: benign