Paralogue Annotation for ANK2 residue 2954

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2954
Reference Amino Acid: N - Asparagine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2954

No paralogue variants have been mapped to residue 2954 for ANK2.

ANK2	SEVYSVTITSPVEDVVVASSSSGTVLSKES>N<FEGQDIKMESQQESTLWEMQSDSVSSSFEP	2984
ANK1	------------------------------>-<------------------------------
ANK3	LEGRHPDRS--------------------->-<---------VFPD-----------------	3517
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.N2954D	c.8860A>G	Putative Benign			SIFT: Polyphen: