Paralogue Annotation for ANK2 residue 2957

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2957
Reference Amino Acid: G - Glycine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2957

No paralogue variants have been mapped to residue 2957 for ANK2.

ANK2	YSVTITSPVEDVVVASSSSGTVLSKESNFE>G<QDIKMESQQESTLWEMQSDSVSSSFEPTMS	2987
ANK1	------------------------------>-<------------------------------
ANK3	RHPDRS------------------------>-<------VFPD------------------TY	3519
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.G2957V	c.8870G>T	Putative Benign			SIFT: Polyphen: