Paralogue Annotation for ANK2 residue 2958

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2958
Reference Amino Acid: Q - Glutamine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2958

No paralogue variants have been mapped to residue 2958 for ANK2.

ANK2	SVTITSPVEDVVVASSSSGTVLSKESNFEG>Q<DIKMESQQESTLWEMQSDSVSSSFEPTMSA	2988
ANK1	------------------------------>-<------------------------------
ANK3	HPDRS------------------------->-<-----VFPD------------------TYF	3520
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.Q2958E	c.8872C>G	Putative Benign			SIFT: Polyphen: