Paralogue Annotation for ANK2 residue 2960

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2960
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2960

No paralogue variants have been mapped to residue 2960 for ANK2.



ANK2TITSPVEDVVVASSSSGTVLSKESNFEGQD>I<KMESQQESTLWEMQSDSVSSSFEPTMSATT2990
ANK1------------------------------>-<------------------------------
ANK3DRS--------------------------->-<---VFPD------------------TYFSY3522
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2960Mc.8880A>G Putative BenignSIFT: tolerated
Polyphen: benign