Paralogue Annotation for ANK2 residue 2962

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2962
Reference Amino Acid: M - Methionine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2962

No paralogue variants have been mapped to residue 2962 for ANK2.

ANK2	TSPVEDVVVASSSSGTVLSKESNFEGQDIK>M<ESQQESTLWEMQSDSVSSSFEPTMSATTTV	2992
ANK1	------------------------------>-<------------------------------
ANK3	S----------------------------->-<-VFPD------------------TYFSYK-	3523
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.M2962I	c.8886G>A	Putative Benign			SIFT: Polyphen: