Paralogue Annotation for ANK2 residue 2977

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2977
Reference Amino Acid: S - Serine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2977

No paralogue variants have been mapped to residue 2977 for ANK2.

ANK2	TVLSKESNFEGQDIKMESQQESTLWEMQSD>S<VSSSFEPTMSATTTVVGEQIS---KVIITK	3004
ANK1	------------------------------>-<------------------------------
ANK3	-----------------VFPD--------->-<--------TYFSYK-VDEEFATPFKT-VAT	3537
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.S2977R	c.8929A>C	Putative Benign		rs369351766	SIFT: tolerated Polyphen: benign