Paralogue Annotation for ANK2 residue 2986

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2986
Reference Amino Acid: M - Methionine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2986

No paralogue variants have been mapped to residue 2986 for ANK2.

ANK2	EGQDIKMESQQESTLWEMQSDSVSSSFEPT>M<SATTTVVGEQIS---KVIITKTDVDSDSWS	3013
ANK1	------------------------------>-<------------------------------
ANK3	--------VFPD------------------>T<YFSYK-VDEEFATPFKT-VATKGLDFDPWS	3546
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.M2986V	c.8956A>G	Putative Benign		rs370499072	SIFT: tolerated Polyphen: benign
p.M2986L	c.8956A>T	Putative Benign			SIFT: tolerated Polyphen: benign
p.M2986T	c.8957T>C	Putative Benign			SIFT: Polyphen:
p.M2986I	c.8958G>A	Putative Benign			SIFT: Polyphen: