Paralogue Annotation for ANK2 residue 2988

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2988
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2988

No paralogue variants have been mapped to residue 2988 for ANK2.



ANK2QDIKMESQQESTLWEMQSDSVSSSFEPTMS>A<TTTVVGEQIS---KVIITKTDVDSDSWSEI3015
ANK1------------------------------>-<------------------------------
ANK3------VFPD------------------TY>F<SYK-VDEEFATPFKT-VATKGLDFDPWSNN3548
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2988Tc.8962G>A BenignSIFT: tolerated
Polyphen: benign