Paralogue Annotation for ANK2 residue 3011

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3011
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3011

No paralogue variants have been mapped to residue 3011 for ANK2.



ANK2PTMSATTTVVGEQIS---KVIITKTDVDSD>S<WSEIREDDEAFEARVKEEEQKIFGLMVDRQ3041
ANK1------------------------------>-<------------------------------
ANK3--TYFSYK-VDEEFATPFKT-VATKGLDFD>P<WSNNRGDDEVFDSKSREDETKPFGLAVEDR3574
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3011Yc.9032C>A Putative Benignrs376455095SIFT: deleterious
Polyphen: probably damaging