Paralogue Annotation for ANK2 residue 3039

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3039
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3039

No paralogue variants have been mapped to residue 3039 for ANK2.



ANK2SDSWSEIREDDEAFEARVKEEEQKIFGLMV>D<RQSQGTTPDTTPARTPTEEGTPTSEQNPFL3069
ANK1------------------------------>-<------------------------------
ANK3FDPWSNNRGDDEVFDSKSREDETKPFGLAV>E<DRSPATTPDTTPARTPTDESTPTSEPNPFP3602
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3039Gc.9116A>G UnknownSIFT:
Polyphen: possibly damaging