Paralogue Annotation for ANK2 residue 304

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 304
Reference Amino Acid: H - Histidine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 304

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
ANK1H277RSpherocytosisHigh9 11102985

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in ANK2.



ANK2SKRGNTNMVKLLLDRGGQIDAKTRDGLTPL>H<CAARSGHDQVVELLLERGAPLLARTKNGLS334
ANK1SRRGNVIMVRLLLDRGAQIETKTKDELTPL>H<CAARNGHVRISEILLDHGAPIQAKTKNGLS307
ANK3SKRGNANMVKLLLDRGAKIDAKTRDGLTPL>H<CGARSGHEQVVEMLLDRAAPILSKTKNGLS336
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

There are currently no reported variants at residue 304 for ANK2.