Paralogue Annotation for ANK2 residue 3063

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3063
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3063

No paralogue variants have been mapped to residue 3063 for ANK2.



ANK2IFGLMVDRQSQGTTPDTTPARTPTEEGTPT>S<EQNPFLFQEGKLFEMTRSGAIDMTKRSYAD3093
ANK1------------------------------>-<------------------------------
ANK3PFGLAVEDRSPATTPDTTPARTPTDESTPT>S<EPNPFPFHEGKMFEMTRSGAIDMSKRDFVE3626
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3063Gc.9187A>G BenignSIFT:
Polyphen: probably damaging