Paralogue Annotation for ANK2 residue 3211

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3211
Reference Amino Acid: C - Cysteine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3211

No paralogue variants have been mapped to residue 3211 for ANK2.



ANK2KEAVSVGTKDLPTVQTGDIPP-LSGVKQIS>C<PDSSEPAVQVQLDFSTLTRSVYSDRGDDSP3241
ANK1------------------------------>-<------------------------------
ANK3KEGPGEITDKIEAVMTSCQGLENETITMIS>N<TANSQMGVRPHEK-HDFQKDNFNNN--NNL3792
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C3211Rc.9631T>C Putative Benignrs139128939SIFT:
Polyphen: possibly damaging