No paralogue variants have been mapped to residue 3267 for ANK2.
| ANK2 | GDDSPDSSPEEQKSVIEIPTAPMENVPFTE>S<KSKIPVRTMPTSTPAPPSAEYESSVSEDFL | 3297 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | --NNLDSSTIQTDNI-------MSNIVLTE>H<--SAPTCTTEKDNPVKVSSGKKTGVLQ--G | 3837 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.S3267R | c.9801C>A | Benign | rs34270799 | SIFT: tolerated Polyphen: possibly damaging |