Paralogue Annotation for ANK2 residue 3267

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3267
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3267

No paralogue variants have been mapped to residue 3267 for ANK2.



ANK2GDDSPDSSPEEQKSVIEIPTAPMENVPFTE>S<KSKIPVRTMPTSTPAPPSAEYESSVSEDFL3297
ANK1------------------------------>-<------------------------------
ANK3--NNLDSSTIQTDNI-------MSNIVLTE>H<--SAPTCTTEKDNPVKVSSGKKTGVLQ--G3837
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3267Rc.9801C>A BenignSIFT: tolerated
Polyphen: possibly damaging