Paralogue Annotation for ANK2 residue 3312

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3312
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3312

No paralogue variants have been mapped to residue 3312 for ANK2.



ANK2APPSAEYESSVSEDFLSSVDEENKADEAKP>K<SKLPVKVPLQR--VEQQLSDLDTSVQKTVA3340
ANK1------------------------------>-<------------------------------
ANK3VKVSSGKKTGVLQ--GHCVRDKQKVLGEQQ>K<TKELIGIRQKSKLPIKATSPKDTFPPNHMS3882
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K3312Mc.9935A>T Putative BenignSIFT: deleterious
Polyphen: probably damaging