No paralogue variants have been mapped to residue 3320 for ANK2.
| ANK2 | SSVSEDFLSSVDEENKADEAKPKSKLPVKV>P<LQR--VEQQLSDLDTSVQKTVAP-QGQDMA | 3347 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | TGVLQ--GHCVRDKQKVLGEQQKTKELIGI>R<QKSKLPIKATSPKDTFPPNHMSNTKASKMK | 3890 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.P3320L | c.9959C>T | Putative Benign | SIFT: tolerated Polyphen: benign | ||
| p.P3320A | c.9958C>G | Putative Benign | SIFT: Polyphen: |