No paralogue variants have been mapped to residue 3322 for ANK2.
| ANK2 | VSEDFLSSVDEENKADEAKPKSKLPVKVPL>Q<R--VEQQLSDLDTSVQKTVAP-QGQDMASI | 3349 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | VLQ--GHCVRDKQKVLGEQQKTKELIGIRQ>K<SKLPIKATSPKDTFPPNHMSNTKASKMKQV | 3892 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.Q3322R | c.9965A>G | Putative Benign | SIFT: Polyphen: |