Paralogue Annotation for ANK2 residue 3340

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3340
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3340

No paralogue variants have been mapped to residue 3340 for ANK2.



ANK2KSKLPVKVPLQR--VEQQLSDLDTSVQKTV>A<P-QGQDMASIAPDNRSKSESDASSLDSKTK3369
ANK1------------------------------>-<------------------------------
ANK3KTKELIGIRQKSKLPIKATSPKDTFPPNHM>S<NTKASKMKQVSQSEKTKALTTSSCVDVKSR3912
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3340Vc.10019C>T Putative BenignSIFT: tolerated
Polyphen: benign
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510