Paralogue Annotation for ANK2 residue 3350

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3350
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3350

No paralogue variants have been mapped to residue 3350 for ANK2.



ANK2R--VEQQLSDLDTSVQKTVAP-QGQDMASI>A<PDNRSKSESDASSLDSKTKCPVKTRSYTET3380
ANK1------------------------------>-<------------------------------
ANK3SKLPIKATSPKDTFPPNHMSNTKASKMKQV>S<QSEKTKALTTSSCVDVKSRIPVKNTHRDNI3923
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3350Tc.10048G>A Putative Benignrs374257100SIFT: tolerated
Polyphen: benign