Paralogue Annotation for ANK2 residue 3588

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3588
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3588

No paralogue variants have been mapped to residue 3588 for ANK2.



ANK2LDFTEEQIHQIRIENPNSLQDQSHALLKYW>L<ERDGKHATDTNLVECLTKINRMDIVHLMET3618
ANK1LQFSVEDINRIRVENPNSLLEQSVALLNLW>V<IREGQNANMENLYTALQSIDRGEIVNMLEG1485
ANK3LNFSVDEINQIRVENPNSLISQSFMLLKKW>V<TRDGKNATTDALTSVLTKINRIDIVTLLEG4172
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3588Vc.10762C>G ConflictSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaLQTS Targeted mutational analysis of ankyrin-B in 541 consecutive, unrelated patients referred for long QT syndrome genetic testing and 200 healthy subjects. Heart Rhythm. 2005 2(11):1218-23. 16253912