Paralogue Annotation for ANK2 residue 3654

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3654
Reference Amino Acid: C - Cysteine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3654

No paralogue variants have been mapped to residue 3654 for ANK2.



ANK2QERISHSYAEIEQTITLDHSEGFSVLQEEL>C<T-----------------------------3655
ANK1NLKPDRRHTDRDYSLSPSQMNGYSSLQDEL>L<SPASLGCALSSPLRADQYWNEVAVLDAIPL1552
ANK3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C3654Sc.10961G>C Putative BenignSIFT:
Polyphen: benign