Paralogue Annotation for ANK2 residue 3654

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3654
Reference Amino Acid: C - Cysteine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 3654

No paralogue variants have been mapped to residue 3654 for ANK2.

ANK2	QERISHSYAEIEQTITLDHSEGFSVLQEEL>C<T-----------------------------	3655
ANK1	NLKPDRRHTDRDYSLSPSQMNGYSSLQDEL>L<SPASLGCALSSPLRADQYWNEVAVLDAIPL	1552
ANK3	------------------------------>-<------------------------------
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.C3654S	c.10961G>C	Putative Benign		rs143803967	SIFT: Polyphen: benign