Paralogue Annotation for ANK2 residue 3811

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3811
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3811

No paralogue variants have been mapped to residue 3811 for ANK2.



ANK2QEPEEP-------------SEHREESSPRK>T<SLVIVESAD--NQPE-TCERLDEDAAFEKG3838
ANK1TEGLEPGGSQEYEKVLVSVSEHTWTEQPEA>E<SSQADRDRRQQGQEEQVQEAKNTFTQVVQG1799
ANK3EEPASP-------------LAAYQKSLEET>S<KLIIEETKP--CVPV-SMKKMSRTSPADGK4338
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3811Nc.11432C>A Inherited ArrhythmiaLQTSrs199473643SIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaLQTS Targeted mutational analysis of ankyrin-B in 541 consecutive, unrelated patients referred for long QT syndrome genetic testing and 200 healthy subjects. Heart Rhythm. 2005 2(11):1218-23. 16253912