Paralogue Annotation for ANK2 residue 3851

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3851
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3851

No paralogue variants have been mapped to residue 3851 for ANK2.



ANK2QPE-TCERLDEDAAFEKGDDMPEIPPETVT>E<EEYIDEHGHTVVKKVTRKIIRRYVSSE---3878
ANK1QEEQVQEAKNTFTQVVQGNEFQNIPGEQVT>E<EQFTDEQGNIVTKKIIRKVVRQIDLSSADA1842
ANK3VPV-SMKKMSRTSPADGKPRLSLHEEEGSS>-<------------------------------4350
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3851Kc.11551G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging