Paralogue Annotation for ANK2 residue 3862

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3862
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3862

No paralogue variants have been mapped to residue 3862 for ANK2.



ANK2DAAFEKGDDMPEIPPETVTEEEYIDEHGHT>V<VKKVTRKIIRRYVSSE---GTEKEEIMVQG3889
ANK1FTQVVQGNEFQNIPGEQVTEEQFTDEQGNI>V<TKKIIRKVVRQIDLSSADAAQEHEEVELRG1853
ANK3TSPADGKPRLSLHEEEGSS----------->-<-------------------GSEQ-------4354
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V3862Mc.11584G>A Other Cardiac PhenotypeSIFT: deleterious
Polyphen: probably damaging
ReportsOther Cardiac Phenotype Defining the cellular phenotype of "ankyrin-B syndrome" variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes. Circulation. 2007 115(4):432-41. 17242276
p.V3862Lc.11584G>C Putative BenignSIFT: deleterious
Polyphen: probably damaging