Paralogue Annotation for ANK2 residue 3922

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3922
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3922

No paralogue variants have been mapped to residue 3922 for ANK2.



ANK2EPVNIEEGDGYSKVIK-RVVLKSDTEQSED>N<NE3924
ANK1QPDLI-EGRKGAQIVKRASLKRGK------>-<-Q1880
ANK3----K-QGEGFKVKTK-KEIRHVEKKSH-->-<-S4377
cons                              > <  

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3922Sc.11765A>G BenignSIFT: tolerated
Polyphen: benign