Paralogue Annotation for ANK2 residue 393

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 393
Reference Amino Acid: A - Alanine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 393

No paralogue variants have been mapped to residue 393 for ANK2.



ANK2LDYLTALHVAAHCGHYRVTKLLLDKRANPN>A<RALNGFTPLHIACKKNRIKVMELLVKYGAS423
ANK1LDHLTPLHVAAHCGHHRVAKVLLDKGAKPN>S<RALNGFTPLHIACKKNHVRVMELLLKTGAS396
ANK3NDYLTALHVAAHCGHYKVAKVLLDKKANPN>A<KALNGFTPLHIACKKNRIKVMELLLKHGAS425
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A393Tc.1177G>A Putative BenignSIFT:
Polyphen: benign
p.A393Sc.1177G>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging