Paralogue Annotation for ANK2 residue 459

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 459
Reference Amino Acid: V - Valine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 459

No paralogue variants have been mapped to residue 459 for ANK2.



ANK2ESGLTPIHVAAFMGHLNIVLLLLQNGASPD>V<TNIRGETALHMAARAGQVEVVRCLLRNGAL489
ANK1ESGLTPLHVASFMGHLPIVKNLLQRGASPN>V<SNVKVETPLHMAARAGHTEVAKYLLQNKAK462
ANK3ESGLTPIHVAAFMGHVNIVSQLMHHGASPN>T<TNVRGETALHMAARSGQAEVVRYLVQDGAQ491
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V459Ic.1375G>A Putative BenignSIFT: tolerated
Polyphen: benign