Paralogue Annotation for ANK2 residue 460

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 460
Reference Amino Acid: T - Threonine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 460

No paralogue variants have been mapped to residue 460 for ANK2.



ANK2SGLTPIHVAAFMGHLNIVLLLLQNGASPDV>T<NIRGETALHMAARAGQVEVVRCLLRNGALV490
ANK1SGLTPLHVASFMGHLPIVKNLLQRGASPNV>S<NVKVETPLHMAARAGHTEVAKYLLQNKAKV463
ANK3SGLTPIHVAAFMGHVNIVSQLMHHGASPNT>T<NVRGETALHMAARSGQAEVVRYLVQDGAQV492
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T460Ac.1378A>G Putative BenignSIFT: tolerated
Polyphen: benign
p.T460Ic.1379C>T Putative BenignSIFT: tolerated
Polyphen: benign