Paralogue Annotation for ANK2 residue 527

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 527
Reference Amino Acid: T - Threonine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 527

No paralogue variants have been mapped to residue 527 for ANK2.



ANK2EQTPLHIASRLGKTEIVQLLLQHMAHPDAA>T<TNGYTPLHISAREGQVDVASVLLEAGAAHS557
ANK1DQTPLHCAARIGHTNMVKLLLENNANPNLA>T<TAGHTPLHIAAREGHVETVLALLEKEASQA530
ANK3DQTPLHISARLGKADIVQQLLQQGASPNAA>T<TSGYTPLHLSAREGHEDVAAFLLDHGASLS559
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T527Ac.1579A>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging