Paralogue Annotation for ANK2 residue 549

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 549
Reference Amino Acid: L - Leucine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 549

No paralogue variants have been mapped to residue 549 for ANK2.



ANK2HMAHPDAATTNGYTPLHISAREGQVDVASV>L<LEAGAAHSLATKKGFTPLHVAAKYGSLDVA579
ANK1NNANPNLATTAGHTPLHIAAREGHVETVLA>L<LEKEASQACMTKKGFTPLHVAAKYGKVRVA552
ANK3QGASPNAATTSGYTPLHLSAREGHEDVAAF>L<LDHGASLSITTKKGFTPLHVAAKYGKLEVA581
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L549Ic.1645C>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging
p.L549Pc.1646T>C Putative BenignSIFT: deleterious
Polyphen: probably damaging