Paralogue Annotation for ANK2 residue 594

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 594
Reference Amino Acid: K - Lysine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 594

No paralogue variants have been mapped to residue 594 for ANK2.



ANK2FTPLHVAAKYGSLDVAKLLLQRRAAADSAG>K<NGLTPLHVAAHYDNQKVALLLLEKGASPHA624
ANK1FTPLHVAAKYGKVRVAELLLERDAHPNAAG>K<NGLTPLHVAVHHNNLDIVKLLLPRGGSPHS597
ANK3FTPLHVAAKYGKLEVANLLLQKSASPDAAG>K<SGLTPLHVAAHYDNQKVALLLLDQGASPHA626
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K594Ec.1780A>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging