Paralogue Annotation for ANK2 residue 704

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 704
Reference Amino Acid: Q - Glutamine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 704

No paralogue variants have been mapped to residue 704 for ANK2.



ANK2HTDMVTLLLDKGANIHMSTKSGLTSLHLAA>Q<EDKVNVADILTKHGADQDAHTKLGYTPLIV734
ANK1HAEMVALLLSKQANGNLGNKSGLTPLHLVA>Q<EGHVPVADVLIKHGVMVDATTRMGYTPLHV707
ANK3HVDMVSLLLGRNANVNLSNKSGLTPLHLAA>Q<EDRVNVAEVLVNQGAHVDAQTKMGYTPLHV736
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q704Ec.2110C>G Putative BenignSIFT:
Polyphen: probably damaging